197Axel-Cyrille Ngonga Ngomo
59Ricardo Usbeck
47Jens Lehmann
43Muhammad Saleem
33Michael Röder
31Sören Auer
23Edgard Marx
22Mohamed Ahmed Sherif
20Tommaso Soru
16Andreas Both
16René Speck
14Daniel Gerber
12Ivan Ermilov
12Diego Moussallem
11Lorenz Bühmann
11Konrad Höffner
10Christina Unger
10Saeedeh Shekarpour
8Qaiser Mehmood
8Claus Stadler
8Robert Hoehndorf
7Amrapali Zaveri
7Diego Esteves
6Stefan Decker
6Matthias Wauer
6Sebastian Hellmann
6Klaus Lyko
6Kleanthi Georgala
5Mohamed Morsey
5Ali Hasnain
5Andre Valdestilhas
5Aftab Iqbal
5Sandro Rautenberg
5Frank Schumacher
4Michael Hoffmann
4Felix Conrads
4Jin-Dong Kim
4Kevin Dreßler
4Aidan Hogan
4Ciro Baron Neto
4Spiros Athanasiou
4Dietrich Rebholz-Schuhmann
4Janet Kelso
3Mofeed M. Hassan
3Michael Martin
3Syeda Sana e Zainab
3Ruben Verborgh
3Markus Nentwig
3Ciro Baron
3Didier Cherix
3Anastasia Krithara
3Giulio Napolitano
3Key-Sun Choi
3Philipp Cimiano
3Eric Gaussier
3Patrick Westphal
3Shanmukha Sampath
3Helena Deus
3Yasar Khan
3Intizar Ali
3Alexander Hinneburg
3Norman Heino
3Erhard Rahm
3Kunal Jha
3Giorgos Giannopoulos
3Daniel Hladky
3Jon Jay Le Grange
3André Freitas
3Michael Dannemann
2Mohamed A. Sherif
2Durre Zehra
2Martin Brümmer
2Christiane Lemke
2Lars Wesemann
2Irini Fundulaki
2Sebastian Walter
2Ioanna Lytra
2Mofeed Hassan
2Sandro Coelho
2Yasir Ismail
2Maulik R Kamdar
2Helena F Deus
2Ali Hasnainb
2Axel-Cyrille Ngomo Ngonga
2Maximilian Speicher
2Ioannis Partalas
2Michael Hartung
2Alejandra Garcia-Rojas
2Konrad Hoeffner
2Robert Isele
2Jiseong Kim
2Gyu-Hyun Choi
2Sampo Pyysalo
2Tomoko Ohta
2Anika Oellrich
2Jörg Unbehauen
2Mirko Spasić
2Milos Jovanovik
2Daniel Obraczka
2Abdullah Fathi Ahmed
1Dimitris Kontokostas
1Adnan Akhter
1Mohamed Sherif
1Olaf Hartig
1Diego Ceccarelli
1Marco Cornolti
1Bernd Eickmann
1Paolo Ferragina
1Andrea Moro
1Roberto Navigli
1Francesco Piccinno
1Giuseppe Rizzo
1Harald Sack
1Raphaël Troncy
1Jörg Waitelonis
1Jonathan Huthmann
1Christian Demmler
1Peter Haase
1Artem Kozlov
1SandroAthaide Coelho
1Wencan Luo
1Bastian Haarmann
1Erik Körner
1Jonathan Huthmann andNico Duldhardt
1Corina Forascu
1Vanessa Lopez
1Elena Cabrio
1George Tsatsaronis
1Michael Schroeder
1Georgios Paliouras
1Yannis Almirantis
1Ion Androutsopoulos
1Patrick Gallinari
1Thierry Artieres
1Michael R. Alvers
1Matthias Zschunke
1Joerg Unbehauen
1Hyndavi Rebba
1Catherine Camilla Romiyo
1Gurudevi Salakki
1Rutuja Suryawanshi
1Danish Ahmed
1Nikit Srivastava
1Mohit Mahajan
1Sergio Oramas
1Luis Espinosa-Anke
1Kuldeep Singh
1Arun Sethupat Radhakrishna
1Akhilesh Vyas
1Akmal Khikmatullaev
1Dharmen Punjani
1Christoph Lange
1Maria-Esther Vidal
1Panayiotis Smeros
1Mohamed Ahmed Sherif andAxel-Cyrille Ngonga Ngomo Abdullah Fathi Ahmed
1Ali Zahir
1Bilal Saeed
1Jonas Almeida
1Shanmukha Sampath Padmanabhuni
1Jonas S. Almeida
1Helena F. Deus
1Josiane Xavier Parreira
1Manfred Hauswirth
1Maulik Kamdar
1Rasheed Hussain
1Shaikh Mohsin
1Kyung-Goo Doh
1Samaneh Nazari Dastjerdi
1Muhammad Intizar Ali
1Anisa Rula
1Matteo Palmonari
1Frank Rosner
1Martin Nettling
1Suresh Pokharel
1Anselmo Peñas
1Hans-Friedrich Witschel
1Victor Christen
1Lars Kolb
1Prodromos Malakasiotis
1Martin Kaltenböck
1Jörg Härtwig
1Klaus-Peter Fähnrich
1Daniel Gerber.
1Karsten Böhm
1Marcos Zampieri Thiago Castro Ferreira
1Maria Claudia Cavalcanti
1Geraldo Xexéo
1Mariana Neves
1Marcos Zampieri
1Mofeed Mohammed
1Gong Cheng
1André Valdestilhas
1Sandro Coelho Athaide
1Adrian M.P. Brasoveanu
1Albert Weichselbraun
1Ali Khalili
1Tim Furche
1Giovanni Grasso
1Christian Schallhart
1Andrew Sellers
1David Liu
1Vadim Zaslawski
1Lorenz Buehmann
1Rene Pietzsch
1Young-gyun Hahm
1Sangha Nam
1Jeong-uk Kim
1 others
1YoungGyun Hahm
1Jeonguk Kim
1Myoung-Gu Kang
1Muntazir Mehdi
1Panagiotis Hasapis
1Ratnesh Sahay
1Mohamed Ahmed Sherif andAxel-Cyrille Ngonga Ngomo Kevin Dreßler
1Anja Jentzsch
1Denny Vrandecic
1Heinrich Herre
1Stanley Hillner
1Christian Chiarcos
1Umair Ul Hassan
1Edward Curry
1Dure Zehra
1Phillip Cimiano
1Alejandra Garcia Rojas
1Vassilis Papakonstantinou
1Henning Petzka
1Martin Gebauer
1Fabr\'ıcio F. de Faria
1Alessio Sarullo
1Tingting Mu
1Julio Cesar Duarte
1Markus Ackermann
1Timofey Ermilov
1Tassilo Pellegrini
1Aad Versteden
1Hajira Jabeen
1Gezim Sejdiu
1Giorgos Argyriou
1Luigi Selmi
1Jürgen Jakobitsch
1Dmitry Mouromtsev
1Dennis Diefenbach
1Kamal Deep Singh
1Pierre Maret
1 Denis Lukovnikov
1 Axel-Cyrille Ngonga Ngomo
1 and Axel-Cyrille Ngonga Ngomo
1Ethem Cem Ozkan
1Erdogan Dogdu
1Sarven Capadisli
1JP Calbimonte
1MD Tran
1D Dell'Aglio
1D Le Phuoc
1Axel Ngonga
1Denis Lukovnikov
1George Balikas
1George Paliouras
1Valter Crescenzi
1Paolo Merialdo
1Disheng Qiu
1Luis Espinosa Anke
1Thierry Declerck
1Dagmar Gromann
1Ram G. Athreya
1Nur Aini Rakhmawati
1Sarasi Lalithsena
1Hamada M. Zahera
1Rricha Jalota
1Ernesto Jiménez-Ruiz
1Tzanina Saveta
1Ondrej Zamazal
1Sven Hertling
1Amina Annane
1Zohra Bellahsene
1Sadok Ben Yahia
1Gayo Diallo
1Daniel Faria
1Marouen Kachroudi
1Abderrahmane Khiat
1Patrick Lambrix
1Huanyu Li
1Maximilian Mackeprang
1Majid Mohammadi
1Maciej Rybinski
1Booma Sowkarthiga Balasubramani
1Cassia Trojahn
1Ria Hari Gusmita
1Giannopoulos Giorgos
1Graux Damien
1Karagiannakis Nikos
1Lehmann Jens
1Patroumpas Kostas
1Dimitrios Skoutas
1Svetlana Pestryakova
1Thiago Castro Ferreira
1Emiel Krahmer
1Sander Wubben

Proceedings of the first Workshop on Bio-Medical Semantic Indexing and Question Answeringproceedings

Published in:

Publication date: 2014

Tags: SIMBAbioasqgroup_akswngonga

Publishing and Interlinking the Global Health Observatory Datasetarticle

Authors: Amrapali Zaveri, Jens Lehmann, Sören Auer, Mofeed M. Hassan, Mohamed A. Sherif, Michael Martin

Published in: Semantic Web Journal

Publication date: 2013

Tags: 2013MOLEauerdiceghogroup_akswhassanlehmannlod2pagemartinpeer-reviewedsherifsimbazaveri

User-driven Quality Evaluation of DBpediainproceedings

Authors: Amrapali Zaveri, Dimitris Kontokostas, Mohamed Ahmed Sherif, Lorenz Bühmann, Mohamed Morsey, Sören Auer, Jens Lehmann

Published in: Proceedings of 9th International Conference on Semantic Systems, I-SEMANTICS '13, Graz, Austria, September 4-6, 2013

Publication date: 2013

Tags: 2013MOLEauerbuehmannbuemanndataqualitydbpediadqdiceevent_I-Semanticsgroup_akswkontokostaslehmannlod2pagemorseysherifsimbatopic_QualityAnalysiszaveri

An Empirical Evaluation of RDF Graph Partitioning Techniquesinproceedings

Authors: Adnan Akhter, Axel-Cyrille Ngonga Ngomo, Muhammad Saleem

Published in: 21st International Conference on Knowledge Engineering and Knowledge Management

Publication date: 2018

Tags: akhterfeasiblegroup_akswlsqngongaquetsalsakesaleemsimba

SPARQL Query Formulation and Execution using FedVizinproceedings

Authors: Syeda Sana e Zainab, Ali Hasnain, Muhammad Saleem, Qaiser Mehmood, Durre Zehra, Stefan Decker

Published in: International Semantic Web Conference (ISWC)

Publication date: 2015

Tags: feasiblegroup_akswlsqquetsalsakesaleemsimba

FedViz: A Visual Interface for SPARQL Queries Formulation and Executioninproceedings

Authors: Syeda Sana e Zainab, Ali Hasnain, Muhammad Saleem, Qaiser Mehmood, Durre Zehra, Stefan Decker

Published in: VOILA at ISWC

Publication date: 2015

Tags: feasiblegroup_akswlsqquetsalsakesaleemsimba

Proceedings of the 3rd International Workshop on Geospatial Linked Data and the 2nd Workshop on Querying the Web of Data co-located with 15th Extended Semantic Web Conference (ESWC 2018), Heraklion, Greece, June 3, 2018proceedings

Authors: Matthias Wauer, Mohamed Sherif, Muhammad Saleem, Olaf Hartig, Ricardo Usbeck, Ruben Verborgh, Axel-Cyrille Ngonga Ngomo

Published in:

Publication date: 2018

Tags: 2018dicedieselgeisergroup_akswngongasaleemsherifsimbausbeckwauer

Where is my URI?inproceedings

Authors: Andre Valdestilhas, Tommaso Soru, Markus Nentwig, Edgard Marx, Muhammad Saleem, Axel-Cyrille Ngonga Ngomo

Published in: European Semantic Web Conference

Publication date: 2018

Tags: Valdestilhasgroup_akswmarkusmarxngongaquetsalsaleemsimbasoru

DIESEL -- Distributed Search over Large Enterprise Datainproceedings

Authors: Ricardo Usbeck, Michael Röder, Muhammad Saleem, Axel-Cyrille Ngonga Ngomo

Published in: ESWC, EU networking session

Publication date: 2016

Tags: dieselgroup_akswngongaroedersaleemsimbausbeck

GERBIL -- General Entity Annotation Benchmark Frameworkinproceedings

Authors: Ricardo Usbeck, Michael Röder, Axel-Cyrille Ngonga Ngomo, Ciro Baron, Andreas Both, Martin Brümmer, Diego Ceccarelli, Marco Cornolti, Didier Cherix, Bernd Eickmann, Paolo Ferragina, Christiane Lemke, Andrea Moro, Roberto Navigli, Francesco Piccinno, Giuseppe Rizzo, Harald Sack, René Speck, Raphaël Troncy, Jörg Waitelonis, Lars Wesemann

Published in: 24th WWW conference

Publication date: 2015

Tags: SIMBAbarongerbilgroup_akswngongaroedersimbaspeckusbeck

Evaluating Entity Annotators Using GERBILinproceedings

Authors: Ricardo Usbeck, Michael Röder, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of 12th European Semantic Web Conference (ESWC 2015)

Publication date: 2015

Tags: geoknowgerbilgroup_akswngongaroedersimbausbeck

Benchmarking Question Answering Systemsarticle

Authors: Ricardo Usbeck, Michael Röder, Michael Hoffmann, Felix Conrads, Jonathan Huthmann, Axel-Cyrille Ngonga Ngomo, Christian Demmler, Christina Unger

Published in: Semantic Web

Publication date: 2019

Tags: dicedieselgroup_akswhoffmannlimpoprojectngongaprojecthobbitqamelroedersimbasolideusbeck

Requirements to Modern Semantic Search Enginesinproceedings

Authors: Ricardo Usbeck, Michael Röder, Peter Haase, Artem Kozlov, Muhammad Saleem, Axel-Cyrille Ngonga Ngomo

Published in: KESW

Publication date: 2016

Tags: SIMBAdieselgroup_akswhobbitngongaprojecthobbitqamelroedersaleemsimbausbeck

AGDISTIS - Graph-Based Disambiguation of Named Entities Using Linked Dataincollection

Authors: Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo, Michael Röder, Daniel Gerber, SandroAthaide Coelho, Sören Auer, Andreas Both

Published in: The Semantic Web -- ISWC 2014

Publication date: 2014

Tags: agdistisauergerbergroup_akswngongaroedersimbausbeck

AGDISTIS - Agnostic Disambiguation of Named Entities Using Linked Open Dataincollection

Authors: Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo, Michael Röder, Sören Auer, Daniel Gerber, Andreas Both

Published in: European Conference on Artificial Intelligence

Publication date: 2014

Tags: 2014agdistisauergerbergroup_akswngongaroedersimbausbeck

Multilingual Disambiguation of Named Entities Using Linked Datainproceedings

Authors: Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo, Wencan Luo, Lars Wesemann

Published in: International Semantic Web Conference (ISWC), Demos & Posters

Publication date: 2014

Tags: agdistisgroup_akswngongasimbausbeck

7th Open Challenge on Question Answering over Linked Data (QALD-7)inproceedings

Authors: Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo, Bastian Haarmann, Anastasia Krithara, Michael Röder, Giulio Napolitano

Published in: Semantic Web Evaluation Challenge

Publication date: 2017

Tags: group_akswngongaprojecthobbitroedersimbausbeck

HAWK - Hybrid Question Answering over Linked Datainproceedings

Authors: Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo, Lorenz Bühmann, Christina Unger

Published in: 12th Extended Semantic Web Conference, Portoroz, Slovenia, 31st May - 4th June 2015

Publication date: 2015

Tags: buehmanngroup_akswhawkngongasimbausbeck

HAWK@QALD5 -- Trying to answer hybrid questions with various simple ranking techniquesinproceedings

Authors: Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo

Published in: CLEF 2015 Labs and Workshops, Notebook Papers. CEUR Workshop Proceedings (

Publication date: 2015

Tags: group_akswhawkngongasimbausbeck

QAMEL -- Question Answering on Mobile Devicesinproceedings

Authors: Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo

Published in: ESWC, EU networking session

Publication date: 2016

Tags: group_akswngongaqamelsimbausbeck

Joint Proceedings of BLINK2017: 2nd International Workshop on Benchmarking Linked Data and NLIWoD3: Natural Language Interfaces for the Web of Data co-located with 16th International Semantic Web Conference (ISWC 2017), Vienna, Austria, October 21st - to - 22nd, 2017proceedings

Authors: Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo, Jin-Dong Kim, Key-Sun Choi, Philipp Cimiano, Irini Fundulaki, Anastasia Krithara

Published in:

Publication date: 2017

Tags: dicedieselgroup_akswlimboprojectngongaproject-hobbitprojecthobbitqamelsimbasolideusbeck

Answering Boolean Hybrid Questions with HAWKinproceedings

Authors: Ricardo Usbeck, Erik Körner, Axel-Cyrille Ngonga Ngomo

Published in: NLIWOD workshop at International Semantic Web Conference (ISWC), including erratum and changes

Publication date: 2015

Tags: dieselgroup_akswhawkngongaqamelsimbausbeck

Using Multi-Label Classification for Improved Question Answeringarticle

Authors: Ricardo Usbeck, Michael Hoffmann, Michael Röder, Jens Lehmann, Axel-Cyrille Ngonga Ngomo

Published in: CoRR

Publication date: 2017

Tags: dicegroup_akswhoffmannlehmannlimboprojectngongaopalqamelroedersimbasolideusbeck

Self-Wiring Question Answering Systemsarticle

Authors: Ricardo Usbeck, Jonathan Huthmann andNico Duldhardt, Axel-Cyrille Ngonga Ngomo

Published in: CoRR

Publication date: 2016

Tags: dieselgroup_akswhawkngongaqamelsimbausbeck

Combining Linked Data and Statistical Information Retrievalinproceedings

Authors: Ricardo Usbeck

Published in: 11th Extended Semantic Web Conference, PhD Symposium

Publication date: 2014

Tags: group_akswsimbausbeck

Analyse von Mikro-Blogging-Datenarticle

Authors: Ricardo Usbeck

Published in: Informatik-Spektrum

Publication date: 2015

Tags: group_akswsimbausbeck

Knowledge Extraction for Hybrid Question Answeringphdthesis

Authors: Ricardo Usbeck

Published in:

Publication date: 2017

Tags: group_akswsimbausbeck

Question Answering over Linked Data (QALD-4)inproceedings

Authors: Christina Unger, Corina Forascu, Vanessa Lopez, Axel-Cyrille Ngonga Ngomo, Elena Cabrio, Philipp Cimiano, Sebastian Walter

Published in: Proceedings of CLEF

Publication date: 2014

Tags: SIMBAgroup_akswngongatbsl

Template-based Question Answering over RDF datainproceedings

Authors: Christina Unger, Lorenz Bühmann, Jens Lehmann, Axel-Cyrille Ngonga Ngomo, Daniel Gerber, Philipp Cimiano

Published in: Proceedings of the 21st international conference on World Wide Web

Publication date: 2012

Tags: 2012MOLESIMBAautosparqlboabuehmanngebergroup_akswlehmannngonga

BioASQ: A Challenge on Large-Scale Biomedical Semantic Indexing and Question Answeringinproceedings

Authors: George Tsatsaronis, Michael Schroeder, Georgios Paliouras, Yannis Almirantis, Ion Androutsopoulos, Eric Gaussier, Patrick Gallinari, Thierry Artieres, Michael R. Alvers, Matthias Zschunke, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of AAAI Information Retrieval and Knowledge Discovery in Biomedical Text

Publication date: 2012

Tags: SIMBAbioasqgroup_akswngonga

Simplified RDB2RDF Mappinginproceedings

Authors: Claus Stadler, Joerg Unbehauen, Patrick Westphal, Mohamed Ahmed Sherif, Jens Lehmann

Published in: Proceedings of the 8th Workshop on Linked Data on the Web (LDOW2015), Florence, Italy

Publication date: 2015

Tags: 2015MOLEdicegeoknowgroup_akswgroup_molelehmannmolepeer-reviewedsherifsimbastadlerwestphal

On Extracting Relations using Distributional Semantics and a Tree Generalizationinproceedings

Authors: René Speck, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of The 21th International Conference on Knowledge Engineering and Knowledge Management (EKAW'2018)

Publication date: 2018

Tags: 2018dicefoxgroup_akswngongaprojecthobbitsimbaspeck

Open Knowledge Extraction Challenge 2018inproceedings

Authors: René Speck, Michael Röder, Felix Conrads, Hyndavi Rebba, Catherine Camilla Romiyo, Gurudevi Salakki, Rutuja Suryawanshi, Danish Ahmed, Nikit Srivastava, Mohit Mahajan, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Evaluation Challenge

Publication date: 2018

Tags: 2018ahmedconradsdicefoxgroup_akswmahajanngongaprojecthobbitrebbaroederromiyosalakkisimbaspecksrivastavasuryawanshi

Open Knowledge Extraction Challenge 2017inproceedings

Authors: René Speck, Michael Röder, Sergio Oramas, Luis Espinosa-Anke, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Evaluation Challenge

Publication date: 2017

Tags: foxgroup_akswngongaprojecthobbitroedersimbaspeck

Leopard — A baseline approach to attribute prediction and validation for knowledge graph populationarticle

Authors: René Speck, Axel-Cyrille Ngonga Ngomo

Published in: Journal of Web Semantics

Publication date: 2018

Tags: 2018SIMBAgroup_akswngongapeer-reviewedprojecthobbitspeck

On Caching for Local Graph Clustering Algorithmsinproceedings

Authors: René Speck, Axel-Cyrille Ngonga Ngomo

Published in: Australasian Conference on Artificial Intelligence

Publication date: 2013

Tags: 2013SIMBAgroup_akswngongapeer-reviewedspeck

Ensemble Learning for Named Entity Recognitionincollection

Authors: René Speck, Axel-Cyrille Ngonga Ngomo

Published in: The Semantic Web -- ISWC 2014

Publication date: 2014

Tags: 2014SIMBAfoxgroup_akswngongaspeck

Named Entity Recognition using FOXinproceedings

Authors: René Speck, Axel-Cyrille Ngonga Ngomo

Published in: International Semantic Web Conference 2014 (ISWC2014), Demos & Posters

Publication date: 2014

Tags: 2014SIMBAfoxgroup_akswngongaspeck

Ensemble Learning of Named Entity Recognition Algorithms using Multilayer Perceptron for the Multilingual Web of Datainproceedings

Authors: René Speck, Axel-Cyrille Ngonga Ngomo

Published in: K-CAP 2017: Knowledge Capture Conference

Publication date: 2017

Tags: dicefoxgeisergroup_akswngongaproject-hobbitprojecthobbitsimbaspeck

Active Learning of Domain-Specific Distances for Link Discoveryinproceedings

Authors: Tommaso Soru, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of JIST

Publication date: 2012

Tags: SIMBAgroup_akswlimeslinkinglodngongasimbasoru

Rapid Execution of Weighted Edit Distancesinproceedings

Authors: Tommaso Soru, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of the Ontology Matching Workshop

Publication date: 2013

Tags: SIMBAgroup_akswlimeslinkinglodngongasimbasorutopic_Interlinking

A Comparison of Supervised Learning Classifiers for Link Discoveryinproceedings

Authors: Tommaso Soru, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of the 10th International Conference on Semantic Systems

Publication date: 2014

Tags: 2014group_akswlinkinglodngongasimbasoru

Enhancing Dataset Quality Using Keysinproceedings

Authors: Tommaso Soru, Edgard Marx, Axel-Cyrille Ngonga Ngomo

Published in: The 14th International Semantic Web Conference (ISWC 2015), Posters & Demonstrations Track

Publication date: 2015

Tags: 2015SIMBAgeoknowgroup_akswlimeslinkinglodmarxngongarockersoru

ROCKER -- A Refinement Operator for Key Discoveryinproceedings

Authors: Tommaso Soru, Edgard Marx, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of the 24th International Conference on World Wide Web, WWW 2015

Publication date: 2015

Tags: 2015SIMBAgeoknowgroup_akswlimeslinkinglodmarxngongarockersoru

Mandolin: A Knowledge Discovery Framework for the Web of Datatechreport

Authors: Tommaso Soru, Diego Esteves, Edgard Marx, Axel-Cyrille Ngonga Ngomo

Published in:

Publication date: 2017

Tags: estevesgroup_akswlinkinglodmarxngongasimbasoru

Why Reinvent the Wheel: Let's Build Question Answering Systems Togetherinproceedings

Authors: Kuldeep Singh, Arun Sethupat Radhakrishna, Andreas Both, Saeedeh Shekarpour, Ioanna Lytra, Ricardo Usbeck, Akhilesh Vyas, Akmal Khikmatullaev, Dharmen Punjani, Christoph Lange, Maria-Esther Vidal, Jens Lehmann, Sören Auer

Published in: Proceedings of the 2018 World Wide Web Conference on World Wide Web, WWW 2018, Lyon, France, April 23-27, 2018

Publication date: 2018

Tags: auergroup_akswlehmannmolesdashekarpoursimbausbeck

Semantic Quran: A Multilingual Resource for Natural-Language Processingarticle

Authors: Mohamed Ahmed Sherif, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Journal

Publication date: 2014

Tags: 2014SIMBAdicegroup_akswlimesngongasemanticquransherifsimba

An Optimization Approach for Load Balancing in Parallel Link Discoveryinproceedings

Authors: Mohamed Ahmed Sherif, Axel-Cyrille Ngonga Ngomo

Published in: SEMANTiCS 2015

Publication date: 2015

Tags: 2015SIMBAdicegeoknowgroup_akswlimesngongasherifsimba

A Systematic Survey of Point Set Distance Measures for Link Discoveryarticle

Authors: Mohamed Ahmed Sherif, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Journal

Publication date: 2017

Tags: 2017DICEgeo-distancegroup_akswlimesngongasherifsimbaslipo

Lion's Den: Feeding the LinkLioninproceedings

Authors: Mohamed Ahmed Sherif, Mofeed Hassan, Tommaso Soru, Axel-Cyrille Ngonga Ngomo, Jens Lehmann

Published in: Proceedings of Ontology Matching Workshop

Publication date: 2016

Tags: DICESIMBAgeoknowgroup_akswhassanlehmannlimesngongasherifsoru

RADON - Rapid Discovery of Topological Relationsinproceedings

Authors: Mohamed Ahmed Sherif, Kevin Dreßler, Panayiotis Smeros, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of The Thirty-First AAAI Conference on Artificial Intelligence (AAAI-17)

Publication date: 2017

Tags: DICESIMBAbioasqgeisergroup_akswhobbitkevinledslimesngongaprojecthobbitradonsherif

RADON2: A buffered-Intersection Matrix Computing Approach To Accelerate Link Discovery Over Geo-Spatial RDF Knowledge Bases (OAEI2018 Results)inproceedings

Authors: Mohamed Ahmed Sherif andAxel-Cyrille Ngonga Ngomo Abdullah Fathi Ahmed

Published in: Proceedings of Ontology Matching Workshop 2018

Publication date: 2018

Tags: 2018abdullahdicedieselgeisergroup_akswhobbitledslimeslinkinglodngongaradonsagesakesherifsimbaslipo

NIF4OGGD - NLP Interchange Format for Open German Governmental Datainproceedings

Authors: Mohamed A. Sherif, Sandro Coelho, Ricardo Usbeck, Sebastian Hellmann, Jens Lehmann, Martin Brümmer, Andreas Both

Published in: The 9th edition of the Language Resources and Evaluation Conference, 26-31 May, Reykjavik, Iceland

Publication date: 2014

Tags: 2014LidmoleMOLEbruemmerdicegroup_akswhellmannkiltlehmannnif4oggdsherifsimbausbeck

Automating Geospatial RDF Dataset Integration and Enrichmentphdthesis

Authors: Mohamed Ahmed Sherif

Published in:

Publication date: 2016

Tags: 2016MOLEdeerdicegeoknowgroup_akswlehmannngongasherifsimba

Automating RDF Dataset Transformation and Enrichmentinproceedings

Authors: Mohamed Ahmed Sherif, Axel-Cyrille Ngonga Ngomo, Jens Lehmann

Published in: 12th Extended Semantic Web Conference, Portoroz, Slovenia, 31st May - 4th June 2015

Publication date: 2015

Tags: 2015MOLEdeerdicegeoknowgroup_akswlehmannngongasherifsimba

WOMBAT - A Generalization Approach for Automatic Link Discoveryinproceedings

Authors: Mohamed Ahmed Sherif, Axel-Cyrille Ngonga Ngomo, Jens Lehmann

Published in: 14th Extended Semantic Web Conference, Portoroz, Slovenia, 28th May - 1st June 2017

Publication date: 2017

Tags: 2017MOLEdicegeoknowgroup_akswlehmannngongasherifsimbawombat

Query Segmentation and Resource Disambiguation Leveraging Background Knowledgeinproceedings

Authors: Saeedeh Shekarpour, Axel-Cyrille Ngonga Ngomo, Sören Auer

Published in: Proceedings of WoLE Workshop

Publication date: 2012

Tags: SIMBAauergroup_akswngongashekarpoursina

Keyword-driven Resource Disambiguation over RDF Knowledge basesinproceedings

Authors: Saeedeh Shekarpour, Axel-Cyrille Ngonga Ngomo, Sören Auer

Published in: Proceedings of JIST

Publication date: 2012

Tags: SIMBAgroup_akswngongashekarpoursimba

SINA: Semantic Interpretation of User Queries for Question Answering on Interlinked Dataarticle

Authors: Saeedeh Shekarpour, Edgard Marx, Axel-Cyrille Ngonga Ngomo, Sören Auer

Published in: Web Semantics

Publication date: 2014

Tags: SIMBAgeoknowgroup_akswlinkinglodmarxngongashekarpoursmart

Keyword-driven SPARQL Query Generation Leveraging Background Knowledgeinproceedings

Authors: Saeedeh Shekarpour, Sören Auer, Axel-Cyrille Ngonga Ngomo, Daniel Gerber, Sebastian Hellmann, Claus Stadler

Published in: International Conference on Web Intelligence

Publication date: 2011

Tags: MOLESIMBAgroup_akswhellmannkiltngongashekarpoursimbasinastadler

Generating SPARQL queries using templatesinproceedings

Authors: Saeedeh Shekarpour, Sören Auer, Axel-Cyrille Ngonga Ngomo, Daniel Gerber, Sebastian Hellmann, Claus Stadler

Published in: WIAS journal,Vol. 11, No. 3, 2013.

Publication date: 2013

Tags: MOLESIMBAgroup_akswhellmannkiltngongashekarpoursimbasinastadlertopic_Search

DC Proposal: Automatically Transforming Keyword Queries to SPARQL on Large-Scale Knowledge Bases.inproceedings

Authors: Saeedeh Shekarpour

Published in: International Semantic Web Conference (2)

Publication date: 2011

Tags: 2011SIMBAgroup_akswshekarpour

Enhanced generic information services using mobile messagingincollection

Authors: Muhammad Saleem, Ali Zahir, Yasir Ismail, Bilal Saeed

Published in: Advances in Grid and Pervasive Computing GPC2010

Publication date: 2010

Tags: group_akswsaleemsimba

SPARQL Querying Benchmarksinproceedings

Authors: Muhammad Saleem, Ricardo Usbeck, Michael Röder, Axel-Cyrille Ngonga Ngomo

Published in: Tutorial at ISWC

Publication date: 2016

Tags: dieselfeasiblegroup_akswlsqngongaprojecthobbitqamelquetsalroedersakesaleemsimbausbeck

TopFed: TCGA Tailored Federated Query Processing and Linking to LODarticle

Authors: Muhammad Saleem, Shanmukha Sampath, Axel-Cyrille Ngonga Ngomo, Aftab Iqbal, Jonas Almeida, Helena Deus

Published in: Journal of Biomedical Semantics

Publication date: 2014

Tags: geoknowgroup_akswngongaquetsalsaleemsimbatcgatopic_Interlinking

Linked Cancer Genome Atlas Databaseinproceedings

Authors: Muhammad Saleem, Shanmukha Sampath Padmanabhuni, Axel-Cyrille Ngonga Ngomo, Jonas S. Almeida, Stefan Decker, Helena F. Deus

Published in: Proceedings of I-Semantics2013

Publication date: 2013

Tags: group_akswlimeslinkinglodngongasaleemsimbatcga

DAW: Duplicate-AWare Federated Query Processing over the Web of Datainproceedings

Authors: Muhammad Saleem, Axel-Cyrille Ngonga Ngomo, Josiane Xavier Parreira, Helena Deus, Manfred Hauswirth

Published in: Proceedings of ISWC2013

Publication date: 2013

Tags: geoknowgroup_akswngongaquetsalsaleemsimbatopic_Querying

HiBISCuS: Hypergraph-Based Source Selection for SPARQL Endpoint Federationinproceedings

Authors: Muhammad Saleem, Axel-Cyrille Ngonga Ngomo

Published in: Extended Semantic Web Conference (ESWC 2014)

Publication date: 2014

Tags: geoknowgroup_akswngongaquetsalsaleemsimba

Automatic SPARQL Benchmark Generation Using FEASIBLEinproceedings

Authors: Muhammad Saleem, Qaiser Mehmood, Axel-Cyrille Ngonga Ngomo

Published in: International Semantic Web Conference (ISWC)

Publication date: 2015

Tags: feasiblegroup_akswlsqngongaquetsalsakesaleemsimba

FEASIBLE: A Feature-Based SPARQL Benchmark Generation Frameworkinproceedings

Authors: Muhammad Saleem, Qaiser Mehmood, Axel-Cyrille Ngonga Ngomo

Published in: International Semantic Web Conference (ISWC)

Publication date: 2015

Tags: feasiblegroup_akswlsqngongaquetsalsakesaleemsimba

A Fine-Grained Evaluation of SPARQL Endpoint Federation Systemsarticle

Authors: Muhammad Saleem, Yasar Khan, Ali Hasnain, Ivan Ermilov, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Journal

Publication date: 2014

Tags: group_akswiermilovngongaquetsalsaleemsimba

An Evaluation of SPARQL Federation Engines Over Multiple Endpointsarticle

Authors: Muhammad Saleem, Yasar Khan, Ali Hasnain, Ivan Ermilov, Axel-Cyrille Ngonga Ngomo

Published in: Technical report

Publication date: 2017

Tags: group_akswquetsalsaleemsimba

Fostering Serendipity through Big Linked Datainproceedings

Authors: Muhammad Saleem, Maulik R Kamdar, Aftab Iqbal, Shanmukha Sampath, Helena F Deus, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Challenge at ISWC2013

Publication date: 2013

Tags: geoknowgroup_akswngongaquetsalsaleemsimbatcgatopic_BigData

Big Linked Cancer Data: Integrating Linked TCGA and PubMedarticle

Authors: Muhammad Saleem, Maulik Kamdar, Aftab Iqbal, Shanmukha Sampath, Helena Deus, Axel-Cyrille Ngonga Ngomo

Published in: Web Semantics: Science, Services and Agents on the World Wide Web

Publication date: 2014

Tags: group_akswngongaquetsalsaleemsimbatcga

Cost effective software engineering using program slicing techniquesinproceedings

Authors: Muhammad Saleem, Rasheed Hussain, Yasir Ismail, Shaikh Mohsin

Published in: Proceedings of the 2nd International Conference on Interaction Sciences: Information Technology, Culture and Human

Publication date: 2009

Tags: group_akswsaleemsimba

LargeRDFBench: A Billion Triples Benchmark for SPARQL Endpoint Federationinproceedings

Authors: Muhammad Saleem, Ali Hasnainb, Axel-Cyrille Ngonga Ngomo

Published in: Journal of Web Semantics (JWS)

Publication date: 2017

Tags: dieselerdoganethemfeasiblegroup_akswlsqngongaprojecthobbitquetsalsakesaleemsimba

Generic Information System Using SMS Gatewayinproceedings

Authors: Muhammad Saleem, Kyung-Goo Doh

Published in: Computer Sciences and Convergence Information Technology, 2009. ICCIT'09. Fourth International Conference on

Publication date: 2009

Tags: group_akswsaleemsimba

Question Answering Over Linked Data: What is Difficult to Answer? What affects the F scores?inproceedings

Authors: Muhammad Saleem, Samaneh Nazari Dastjerdi, Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo

Published in: Natural Language Interfaces workshop at ISWC

Publication date: 2017

Tags: dieselgroup_akswlimboprojectngongaopalprojecthobbitqamelsaleemsamansimbasolideusbeck

Federated Query Processing over Linked Datainproceedings

Authors: Muhammad Saleem, Muhammad Intizar Ali, Ruben Verborgh, Axel-Cyrille Ngonga Ngomo

Published in: Tutorial at ISWC

Publication date: 2015

Tags: group_akswngongaquetsalsakesaleemsimba

LSQ: The Linked SPARQL Queries Datasetinproceedings

Authors: Muhammad Saleem, Intizar Ali, Aidan Hogan, Qaiser Mehmood, Axel-Cyrille Ngonga Ngomo

Published in: International Semantic Web Conference (ISWC)

Publication date: 2015

Tags: feasiblegroup_akswlsqngongaquetsalsakesaleemsimba

LSQ: The Linked SPARQL Queries Dataset Technical Reportinproceedings

Authors: Muhammad Saleem, Intizar Ali, Aidan Hogan, Qaiser Mehmood, Axel-Cyrille Ngonga Ngomo

Published in: LSQ Technical Report

Publication date: 2015

Tags: feasiblegroup_akswlsqngongaquetsalsakesaleemsimba

The LSQ Dataset: Querying for Queriesinproceedings

Authors: Muhammad Saleem, Intizar Ali, Aidan Hogan, Qaiser Mehmood, Axel-Cyrille Ngonga Ngomo

Published in: International Semantic Web Conference (ISWC)

Publication date: 2015

Tags: feasiblegroup_akswlsqngongaquetsalsakesaleemsimba

Efficient Source Selection For SPARQL Endpoint Query Federationinproceedings

Authors: Muhammad Saleem

Published in: PhD thesis at AKSW, University of Leipzig Germany

Publication date: 2016

Tags: dieselerdoganethemfeasiblegroup_akswlsqngongaprojecthobbitquetsalsakesaleemsimba

Efficient Source Selection and Benchmarking for SPARQL Endpoint Query Federationarticle

Authors: Muhammad Saleem

Published in: Technical report

Publication date: 2017

Tags: group_akswquetsalsaleemsimba

Hybrid Acquisition of Temporal Scopes for RDF Datainproceedings

Authors: Anisa Rula, Matteo Palmonari, Axel-Cyrille Ngonga Ngomo, Daniel Gerber, Jens Lehmann, Lorenz Bühmann

Published in: Proc. of the Extended Semantic Web Conference 2014

Publication date: 2014

Tags: 2014MOLESIMBAbuehmanngerbergroup_akswlehmannlod2pagengonga

Evaluating topic coherence measuresarticle

Authors: Frank Rosner, Alexander Hinneburg, Michael Röder, Martin Nettling, Andreas Both

Published in: CoRR

Publication date: 2014

Tags: SIMBAgroup_akswpalmettoroeder

Linked Data Workflow Project Ontology: Uma ontologia de domínio para publicacão de dados conectadosinproceedings

Authors: Sandro Rautenberg, Edgard Marx, Ivan Ermilov, Sören Auer

Published in: XVII Encontro Nacional de Pesquisa em Ciência da Informacão

Publication date: 2016

Tags: 2016auercoelhogroup_akswiermilovmarxmoleopenqarautenbergsimbasmart

LODFlow -- a Workflow Management System for Linked Data Processinginproceedings

Authors: Sandro Rautenberg, Ivan Ermilov, Edgard Marx, Sören Auer, Axel-Cyrille Ngomo Ngonga

Published in: SEMANTiCS 2015

Publication date: 2015

Tags: 2015SIMBAauergeoknowgroup_akswiermilovmarxngongarautenbergsakesimba

LDWPO - A Lightweight Ontology for Linked Data Managementinproceedings

Authors: Sandro Rautenberg, Ivan Ermilov, Edgard Marx, Sören Auer

Published in: ONTOBRAS 2016

Publication date: 2016

Tags: 2016SIMBAauergroup_akswiermilovmarxrautenbergsimba

CETUS -- A Baseline Approach to Type Extractioninproceedings

Authors: Michael Röder, Ricardo Usbeck, René Speck, Axel-Cyrille Ngonga Ngomo

Published in: 1st Open Knowledge Extraction Challenge @ 12th European Semantic Web Conference (ESWC 2015)

Publication date: 2015

Tags: agdistisgroup_akswngongaroedersimbaspeckusbeck

Developing a Sustainable Platform for Entity Annotation Benchmarksinproceedings

Authors: Michael Röder, Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo

Published in: ESWC Developers Workshop 2015

Publication date: 2015

Tags: gerbilgroup_akswngongaroedersimbausbeck

Techreport for GERBIL 1.2.2 - V1techreport

Authors: Michael Röder, Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo

Published in:

Publication date: 2016

Tags: gerbilgroup_akswngongaprojecthobbitroedersimbausbeck

GERBIL - Benchmarking Named Entity Recognition and Linking consistentlyarticle

Authors: Michael Röder, Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web

Publication date: 2018

Tags: dicedieselgerbilgroup_akswngongaprojecthobbitqamelroedersimbausbeck

The Scalable Question Answering Over Linked Data (SQA) Challenge 2018inproceedings

Authors: Giulio Napolitano, Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Challenges - 5th SemWebEval Challenge at ESWC 2018, Heraklion, Greece, June 3-7, 2018, Revised Selected Papers

Publication date: 2018

Tags: dicegerbilgroup_akswngongaprojecthobbitqamelroedersimbausbeck

N3 - A Collection of Datasets for Named Entity Recognition and Disambiguation in the NLP Interchange Formatinproceedings

Authors: Michael Röder, Ricardo Usbeck, Sebastian Hellmann, Daniel Gerber, Andreas Both

Published in: The 9th edition of the Language Resources and Evaluation Conference, 26-31 May, Reykjavik, Iceland

Publication date: 2014

Tags: LiderEUagdistisgerbergroup_akswhellmannkiltn3roedersimbausbeck

Detecting Similar Linked Datasets Using Topic Modellinginbook

Authors: Michael Röder, Axel-Cyrille Ngonga Ngomo, Ivan Ermilov, Andreas Both

Published in: The Semantic Web. Latest Advances and New Domains: 13th International Conference, ESWC 2016, Heraklion, Crete, Greece, May 29 -- June 2, 2016, Proceedings

Publication date: 2016

Tags: group_akswiermilovngongaprojecthobbitroedersimbatapioca

Evaluation des Konfigurationsraumes von Kohärenzmaßen fur Themenmodelleinproceedings

Authors: Michael Röder, Andreas Both, Alexander Hinneburg

Published in: Proceedings of the 16th LWA Workshops: KDML, IR and FGWM, Aachen, Germany, September 8-10

Publication date: 2014

Tags: SIMBAgroup_akswpalmettoroeder

Exploring the Space of Topic Coherence Measuresinproceedings

Authors: Michael Röder, Andreas Both, Alexander Hinneburg

Published in: Proceedings of the eight International Conference on Web Search and Data Mining, Shanghai, February 2-6

Publication date: 2015

Tags: SIMBAgroup_akswpalmettoroeder

Investigating Quality Raters' Performance Using Interface Evaluation Methodsinproceedings

Authors: Michael Röder, Maximilian Speicher, Ricardo Usbeck

Published in: Informatik 2013, 43. Jahrestagung der Gesellschaft für Informatik e.V. (GI), Informatik angepasst an Mensch, Organisation und Umwelt, 16.-20. September 2013, Koblenz

Publication date: 2013

Tags: group_akswroedersimbausbeck

Ontology Based Data Access and Integration for Improving the Effectiveness of Farming in Nepalinproceedings

Authors: Suresh Pokharel, Mohamed Ahmed Sherif, Jens Lehmann

Published in: Proc. of the International Conference on Web Intelligence

Publication date: 2014

Tags: 2014MOLEdicegroup_akswlehmannsherifsimbatopic_geospatial

Overview of CLEF Question Answering Track 2014inproceedings

Authors: Anselmo Peñas, Christina Unger, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of CLEF

Publication date: 2014

Tags: SIMBAgroup_akswlimesngonga

Results of the First BioASQ Workshopinproceedings

Authors: Ioannis Partalas, Eric Gaussier, Axel-Cyrille Ngonga Ngomo

Published in: BioASQ@CLEF

Publication date: 2013

Tags: 2013SIMBAbioasqgroup_akswngongapeer-reviewed

A framework for adaptive information retrievalinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Hans-Friedrich Witschel

Published in: Proceedings of the first International Conference on Theoeretical Information Retrieval

Publication date: 2007

Tags: SIMBAgroup_akswngonga

Unsupervised Link Discovery Through Knowledge Base Repairinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Mohamed Ahmed Sherif, Klaus Lyko

Published in: Extended Semantic Web Conference (ESWC 2014)

Publication date: 2014

Tags: DICESIMBAgroup_akswlimeslykongongasherifsimba

Implicit Knowledge Sharinginproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Frank Schumacher

Published in: Proceedings of the 7th European Conference on Knowledge Management

Publication date: 2006

Tags: SIMBAevent_eckmgroup_akswngonga

Involving the User in Semantic Searchinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Frank Schumacher

Published in: Proceedings of the HCI International

Publication date: 2007

Tags: SIMBAevent_hciigroup_akswngonga

Disentangling the Wikipedia Category Graph for Corpus Extractionincollection

Authors: Axel-Cyrille Ngonga Ngomo, Frank Schumacher

Published in: Posters of CICLING 2009

Publication date: 2009

Tags: SIMBAgroup_akswngonga

Disentangling the Wikipedia Category Graph for Corpus Extractionarticle

Authors: Axel-Cyrille Ngonga Ngomo, Frank Schumacher

Published in: Research Journal on Computer science and Computer Engineering with Applications

Publication date: 2009

Tags: SIMBAgroup_akswngonga

Border Flow---A local graph clustering algorithm for Natural Language Processinginproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Frank Schumacher

Published in: Proceedings of the 10th International Conference on Intelligent Text Processing and Computational Linguistics (CICLING 2009)

Publication date: 2009

Tags: SIMBAevent_ciclinggroup_akswngonga

Federated Query Processing: Challenges and Opportunitiesinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Muhammad Saleem

Published in: Keynote at PROFILES at Extended Semantic Web Conference (ESWC)

Publication date: 2016

Tags: dieselfeasiblegroup_akswlsqngongaprojecthobbitquetsalsakesaleemsimba

Cross-Document Coreference Resolution using Latent Featuresinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Michael Röder, Ricardo Usbeck

Published in: LD4IE---Linked Data for Information Extraction at ISWC 2014

Publication date: 2014

Tags: agdistisgroup_akswngongaroedersimbausbeck

HOBBIT: Holistic Benchmarking for Big Linked Datainproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Michael Röder

Published in: ESWC, EU networking session

Publication date: 2016

Tags: group_akswngongaprojecthobbitroedersimba

COALA---Correlation-Aware Active Learning of Link Specificationsinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Klaus Lyko, Victor Christen

Published in: Proceedings of ESWC

Publication date: 2013

Tags: SIMBAgroup_akswlimeslinkinglodlykongongascmstopic_Interlinking

EAGLE: Efficient Active Learning of Link Specifications using Genetic Programminginproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Klaus Lyko

Published in: Proceedings of ESWC

Publication date: 2012

Tags: SIMBAgroup_akswlimeslykongongascms

Unsupervised learning of link specifications: deterministic vs. non-deterministicinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Klaus Lyko

Published in: Proceedings of the Ontology Matching Workshop

Publication date: 2013

Tags: SIMBAgroup_akswlimeslinkinglodlykongongascmstopic_Interlinking

RAVEN: Active Learning of Link Specificationsinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Jens Lehmann, Sören Auer, Konrad Höffner

Published in: Proceedings of the Ontology Matching Workshop (co-located with ISWC)

Publication date: 2011

Tags: 2011MOLESIMBAauergroup_akswhoeffnerlehmannngongascms

RAVEN---Towards Zero-Configuration Link Discoverytechreport

Authors: Axel-Cyrille Ngonga Ngomo, Jens Lehmann, Sören Auer, Konrad Höffner

Published in:

Publication date: 2012

Tags: 2012MOLESIMBAauergroup_akswhoeffnerlehmannngongascms

When to Reach for the Cloud: Using Parallel Hardware for Link Discovery.inproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Lars Kolb, Norman Heino, Michael Hartung, Sören Auer, Erhard Rahm

Published in: Proceedings of ESCW

Publication date: 2013

Tags: SIMBAauergroup_akswheinolimeslinkinglodngongascmstopic_Interlinking

Holistic and Scalable Ranking of RDF Datainproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Michael Hoffmann, Ricardo Usbeck, Kunal Jha

Published in: 2017 IEEE International Conference on Big Data

Publication date: 2017

Tags: dicedieselgroup_akswharehoffmannkunaljhalimboprojectngongaopalproject-hobbitprojecthobbitqamelsimbausbeck

A tool suite for creating Question Answering benchmarksinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Norman Heino, René Speck, Prodromos Malakasiotis

Published in: Proceedings of LREC

Publication date: 2014

Tags: SIMBAbioasqgroup_akswheinongongaspeck

SCMS - Semantifying Content Management Systemsinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Norman Heino, Klaus Lyko, René Speck, Martin Kaltenböck

Published in: ISWC 2011

Publication date: 2011

Tags: SIMBAgroup_akswheinolykongongascmsspeck

Kontext-dynamische Informationsversorgung durch Prozesse und Ontologieninproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Jörg Härtwig

Published in: Tagungsband LIT'04

Publication date: 2004

Tags: SIMBAlanguage_deutschngonga

Der Informationsraum als Metapher für die Realisierung dynamischer Informationsbedürfnisse im Kontext rollenbasierter Communitiesinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Klaus-Peter Fähnrich

Published in: Proceedings of LIT03

Publication date: 2003

Tags: SIMBAlanguage_deutschngonga

Sorry, I don't speak SPARQL --- Translating SPARQL Queries into Natural Languageinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Lorenz Bühmann, Christina Unger, Jens Lehmann, Daniel Gerber.

Published in: Proceedings of WWW

Publication date: 2013

Tags: 2013MOLESIMBAbioasqbuehmanngerbergroup_akswlehmannngonga

Building Adaptive Knowledge Spaces by Combining Machine Learning Algorithms with Ontologies and Text Mining Technologiesinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Karsten Böhm

Published in: 29th Annual Conference of the German Classification Society

Publication date: 2005

Tags: SIMBAngonga

Introduction to Linked Data and Its Lifecycle on the Webinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Sören Auer, Jens Lehmann, Amrapali Zaveri

Published in: Reasoning Web

Publication date: 2014

Tags: 2014MOLESIMBAauerdataqualitygroup_akswlehmannlimesngongasimbatopic_GeoSemWebzaveri

LIMES - A Time-Efficient Approach for Large-Scale Link Discovery on the Web of Datainproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Sören Auer

Published in: Proceedings of IJCAI

Publication date: 2011

Tags: SIMBAgroup_akswlimesngongascms

Clique-Based Clusteringinproceedings

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Proceeding of the IASTED Knowledge Sharing and Collaborative Engineering Conference

Publication date: 2006

Tags: SIMBAgroup_akswngonga

Adaptive and Context-Sensitive Information Retrievalinproceedings

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of the third International Conference on Knowledge Management

Publication date: 2006

Tags: SIMBAgroup_akswngonga

Adaptive and Context-Sensitive Information Retrievalincollection

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Creating Collaborative Advantage Through Knowledge and Innovation

Publication date: 2007

Tags: SIMBAgroup_akswngonga

Towards an implicit and collaborative evolution of terminological ontologiesincollection

Authors: Axel-Cyrille Ngonga Ngomo

Published in: BUILDING THE KNOWLEDGE SOCIETY ON THE INTERNET---sharing and exchanging knowledge in networked environments

Publication date: 2007

Tags: SIMBAgroup_akswngonga

Knowledge-Free Discovery of Domain-Specific Multi-Word Unitsinproceedings

Authors: Axel-Cyrille Ngonga Ngomo

Published in: ACM Symposium on Applied Computing (ACM SAC)

Publication date: 2008

Tags: SIMBAevent_sacgroup_akswngonga

SIGNUM---A Graph Algorithm for Terminology Extractioninproceedings

Authors: Axel-Cyrille Ngonga Ngomo

Published in: roceedings of the 9th International Conference on Intelligent Text Processing and Computational Linguistics (CICLING 2008)

Publication date: 2008

Tags: SIMBAevent_ciclinggroup_akswngonga

Low-Bias Extraction of Domain-Specific Conceptsphdthesis

Authors: Axel-Cyrille Ngonga Ngomo

Published in:

Publication date: 2009

Tags: SIMBAgroup_akswngonga

Low-Bias Extraction of Domain-Specific Concepts.incollection

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Posters of CICLING 2009

Publication date: 2009

Tags: SIMBAgroup_akswngonga

Low-Bias Extraction of Domain-Specific Conceptsarticle

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Informatica

Publication date: 2010

Tags: SIMBAgroup_akswngonga

A Time-Efficient Hybrid Approach to Link Discoveryinproceedings

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of OM@ISWC

Publication date: 2011

Tags: SIMBAgroup_akswlimesngongascms

On Link Discovery using a Hybrid Approacharticle

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Journal on Data Semantics

Publication date: 2012

Tags: SIMBAgroup_akswlimeslinkinglodngongascms

Learning conformation rules for linked data integrationinproceedings

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of Seventh International Workshop on Ontology Matching

Publication date: 2012

Tags: SIMBAaloegroup_akswlimesngongascms

Link Discovery with Guaranteed Reduction Ratio in Affine Spaces with Minkowski Measuresinproceedings

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of ISWC

Publication date: 2012

Tags: SIMBAgroup_akswlimeslinkinglodngongascms

ORCHID - Reduction-Ratio-Optimal Computation of Geo-Spatial Distances for Link Discoveryinproceedings

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of ISWC 2013

Publication date: 2013

Tags: SIMBAgeoknowgroup_akswlinkinglodngongatopic_Interlinking

HELIOS -- Execution Optimization for Link Discoveryinproceedings

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of ISWC

Publication date: 2014

Tags: SIMBAgeoknowgroup_akswlimesngonga

Parameter-Free Clustering of Protein-Protein Interaction Graphsinproceedings

Authors: Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of Symposium on Machine Learning in Systems Biology 2010

Publication date: 2010

Tags: SIMBAgroup_akswngonga

Transfer Learning of Link Specificationsinproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Jens Lehmann, Mofeed Hassan

Published in: Seventh IEEE International Conference on Semantic Computing (ICSC)

Publication date: 2013

Tags: 2013MOLESIMBAgroup_akswgroup_molehassanlehmannngongapeer-reviewedtopic_Interlinking

WASOTA: What are the states of the art?inproceedings

Authors: Ciro Baron Neto, Diego Esteves, Tommaso Soru, Diego Moussallem, Andre Valdestilhas, Edgard Marx

Published in: 12th International Conference on Semantic Systems (SEMANTiCS 2016), 12-15 September 2016, Leipzig, Germany (Posters & Demos)

Publication date: 2016

Tags: 2016akswbaronciroestevesgroup_akswmarxmexmolemoussallemsimbasoruvaldestilhas

LinkLion: A Link Repository for the Web of Datainproceedings

Authors: Markus Nentwig, Tommaso Soru, Axel-Cyrille Ngonga Ngomo, Erhard Rahm

Published in: Proceedings of ESWC

Publication date: 2014

Tags: 2014SIMBAgroup_akswgroup_molelinkinglodngongapeer-reviewedsorutopic_Interlinking

A survey of current Link Discovery frameworksarticle

Authors: Markus Nentwig, Michael Hartung, Axel-Cyrille Ngonga Ngomo, Erhard Rahm

Published in: Semantic Web

Publication date: 2015

Tags: 2015SIMBAgroup_akswledslinkinglodngongapeer-reviewedtopic_Interlinking

Machine Translation using Semantic Web Technologies: A Surveyarticle

Authors: Diego Moussallem, Matthias Wauer, Axel-Cyrille Ngonga Ngomo

Published in: Journal of Web Semantics

Publication date: 2018

Tags: dicegroup_akswmoussallemngongaprojecthobbitsimbawauer

MAG: A Multilingual, Knowledge-base Agnostic and Deterministic Entity Linking Approachinproceedings

Authors: Diego Moussallem, Ricardo Usbeck, Michael Röder, Axel-Cyrille Ngonga Ngomo

Published in: K-CAP 2017: Knowledge Capture Conference

Publication date: 2017

Tags: agdistisdicedieselgroup_akswlimboprojectmoussallemngongaopalproject-hobbitprojecthobbitqamelroedersimbasolideusbeck

Entity Linking in 40 Languages using MAGinproceedings

Authors: Diego Moussallem, Ricardo Usbeck, Michael Röder, Axel-Cyrille Ngonga Ngomo

Published in: The Semantic Web, ESWC 2018, Lecture Notes in Computer Science

Publication date: 2018

Tags: agdistisdicedieselgroup_akswlimboprojectmoussallemngongaopalqamelroedersimbasolideusbeck

RDF2PT: Generating Brazilian Portuguese Texts from RDF Datainproceedings

Authors: Diego Moussallem, Marcos Zampieri Thiago Castro Ferreira, Maria Claudia Cavalcanti, Geraldo Xexéo, Mariana Neves, Axel-Cyrille Ngonga Ngomo

Published in: The 11th edition of the Language Resources and Evaluation Conference, 7-12 May 2018, Miyazaki (Japan)

Publication date: 2018

Tags: dieselgeisergroup_akswmoussallemngongaprojecthobbitrdf2ptsagesimbaslipo

LIdioms: A Multilingual Linked Idioms Data Setinproceedings

Authors: Diego Moussallem, Mohamed Ahmed Sherif, Diego Esteves, Marcos Zampieri, Axel-Cyrille Ngonga Ngomo

Published in: The 11th edition of the Language Resources and Evaluation Conference, 7-12 May 2018, Miyazaki (Japan)

Publication date: 2018

Tags: dicedieselestevesgeisergroup_akswlidiommoussallemngongaprojecthobbitsagesherifsimbaslipo

DBpedia SPARQL Benchmark---Performance Assessment with Real Queries on Real Datainproceedings

Authors: Mohamed Morsey, Jens Lehmann, Sören Auer, Axel-Cyrille Ngonga Ngomo

Published in: ISWC 2011

Publication date: 2011

Tags: 2011MOLESIMBAauerdbpsbgroup_akswlehmannlimesmorseyngonga

Usage-Centric Benchmarking of RDF Triple Storesinproceedings

Authors: Mohamed Morsey, Jens Lehmann, Sören Auer, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of the 26th AAAI Conference on Artificial Intelligence (AAAI 2012)

Publication date: 2012

Tags: 2012MOLESIMBAauerdbpsbgroup_akswlehmannlimesmorseyngonga

DBtrends : Exploring Query Logs for Ranking RDF Datainproceedings

Authors: Edgard Marx, Amrapali Zaveri, Diego Moussallem, Sandro Rautenberg

Published in: Proceedings of the 12th International Conference on Semantic Systems

Publication date: 2016

Tags: 2016SIMBAdbtrendsgroup_akswmarxmoussallemopenqaprojecthobbitrautenbergsmartzaveri

DBtrends : Publishing and Benchmarking RDF Ranking Functionsinproceedings

Authors: Edgard Marx, Amrapali Zaveri, Mofeed Mohammed, Sandro Rautenberg, Jens Lehmann, Axel-Cyrille Ngonga Ngomo, Gong Cheng

Published in: 2nd International Workshop on Summarizing and Presenting Entities and Ontologies, co-located with the 13th Extended Semantic Web Conference

Publication date: 2016

Tags: 2016SIMBAdbtrendsgroup_akswhassanlehmannmarxmolengongaopenqaprojecthobbitrautenbergsmartzaveri

Towards an Open Question Answering Architectureinproceedings

Authors: Edgard Marx, Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo, Konrad Höffner, Jens Lehmann, Sören Auer

Published in: Proceedings of the 10th International Conference on Semantic Systems

Publication date: 2014

Tags: MOLEgroup_akswhoeffnerlehmannmarxmolengongaopenqasimbasmartusbeck

Triple Scoring Using a Hybrid Fact Validation Approach - The Catsear Triple Scorer at WSDM Cup 2017inproceedings

Authors: Edgard Marx, Tommaso Soru, André Valdestilhas

Published in: WSDM Cup, co-located with the 10th ACM International Conference on Web Search and Data Mining

Publication date: 2017

Tags: 2017akswcrossgraphesevent_WSDMgroup_akswkboxmarxpcponwebscoresimbasmartsorustarpathtriplevaldestilhas

KBox: Distributing Ready-to-query RDF Knowledge Graphsinproceedings

Authors: Edgard Marx, Tommaso Soru, Ciro Baron Neto, Sandro Coelho Athaide

Published in: Proceedings of ESWC Posters and Demos

Publication date: 2017

Tags: 2017akswbaroncoelhogroup_akswkboxlod2pagemarxpcponwebsimbasmartsoru

An Open Question Answering Frameworkinproceedings

Authors: Edgard Marx, Tommaso Soru, Diego Esteves, Axel-Cyrille Ngonga Ngomo, Jens Lehmann

Published in: The 14th International Semantic Web Conference, Posters & Demonstrations Track

Publication date: 2015

Tags: 2015SIMBAestevesgroup_akswlehmannmarxmolengongaopenqasmartsoru

Torpedo: Improving the State-of-the-Art RDF~Dataset~Slicinginproceedings

Authors: Edgard Marx, Saeedeh Shekarpour, Tommaso Soru, Adrian M.P. Brasoveanu, Muhammad Saleem, Ciro Baron, Albert Weichselbraun, Jens Lehmann, Axel-Cyrille Ngonga Ngomo, Sören Auer

Published in: 11th IEEE International Conference on Semantic Computing, Jan 30-Feb 1, 2017, San Diego, California, USA

Publication date: 2017

Tags: 2017akswauerbaronevent_ICSCgroup_akswlehmannlod2pagemarxmolengongardfslicesaleemsimbasoru

A Decentralized Architecture for SPARQL Query Processing and RDF Sharing: A Position Paperinproceedings

Authors: Edgard Marx, Muhammad Saleem, Ioanna Lytra, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Computing (ICSC), 2018 IEEE 12th International Conference on

Publication date: 2018

Tags: group_akswlytramarxngongapcponwebquetsalsaleemsimba

Semantic Search User Interface Patterns: An Introductioninproceedings

Authors: Edgard Marx, Ali Khalili, Andre Valdestilhas

Published in: Human Computer Interaction (HCI-Europe) 2017, Plzen, Czech Republic

Publication date: 2017

Tags: 2017SIMBAgroup_akswmarxmoleopenqapcponwebsmartsmilevaldestilhas

Exploring Term Networks for Semantic Search over RDF Knowledge Graphsinproceedings

Authors: Edgard Marx, Konrad Höffner, Saeedeh Shekarpour, Axel-Cyrille Ngonga Ngomo, Jens Lehmann, Sören Auer

Published in: Metadata and Semantics Research: 10th International Conference, MTSR 2016, Göttingen, Germany, November 22-25, 2016, Proceedings

Publication date: 2016

Tags: MOLEgroup_akswhoeffnerlehmannmarxmolengongaopenqasimbasmart

Answering Live Questions from Heterogeneous Data Sourcesinproceedings

Authors: Edgard Marx, Sandro Coelho

Published in: 25th Text Retrieval Conference (TREC 2016), Live QA Track, 15 November 2016, Montgomery County MD, USA

Publication date: 2016

Tags: 2016SIMBAcoelhogroup_akswmarxmoleopenqasmart

KBox: Transparently Shifting Query Execution on Knowledge Graphs to the Edgeinproceedings

Authors: Edgard Marx, Ciro Baron, Tommaso Soru, Sören Auer

Published in: 11th IEEE International Conference on Semantic Computing, Jan 30-Feb 1, 2017, San Diego, California, USA

Publication date: 2017

Tags: 2017akswauerbaronevent_ICSCgroup_akswkboxlod2pagemarxmolesimbasmartsoru

SAIM---One Step Closer to Zero-Configuration Link Discoveryinproceedings

Authors: Klaus Lyko, Konrad Höffner, René Speck, Axel-Cyrille Ngonga Ngomo, Jens Lehmann

Published in: Proc. of the Extended Semantic Web Conference Posters & Demos

Publication date: 2013

Tags: 2013MOLEgeoknowgroup_akswgroup_molehoeffnerlehmannlimeslod2pagelykomolengongapeer-reviewedscmssimbaspecktopic_Interlinking

DeFacto - Deep Fact Validationinproceedings

Authors: Jens Lehmann, Daniel Gerber, Mohamed Morsey, Axel-Cyrille Ngonga Ngomo

Published in: Proc. of the International Semantic Web Conference

Publication date: 2012

Tags: 2012MOLESIMBAboadefactogerbergroup_akswlehmannmorseyngonga

DEQA: Deep Web Extraction for Question Answeringinproceedings

Authors: Jens Lehmann, Tim Furche, Giovanni Grasso, Axel-Cyrille Ngonga Ngomo, Christian Schallhart, Andrew Sellers, Christina Unger, Lorenz Bühmann, Daniel Gerber, Konrad Höffner, David Liu, Sören Auer

Published in: Proceedings of ISWC

Publication date: 2012

Tags: 2012MOLESIMBAauerboabuehmanngerbergroup_akswhoeffnerlehmannlimesngonga

Managing Geospatial Linked Data in the GeoKnow Projectinbook

Authors: Jens Lehmann, Spiros Athanasiou, Andreas Both, Alejandra Garcia-Rojas, Giorgos Giannopoulos, Daniel Hladky, Konrad Hoeffner, Jon Jay Le Grange, Axel-Cyrille Ngonga Ngomo, Mohamed Ahmed Sherif, Claus Stadler, Matthias Wauer, Patrick Westphal, Vadim Zaslawski

Published in:

Publication date: 2015

Tags: 2015MOLEdicegeoknowgroup_akswhoeffnerlehmannngongasherifsimbawauerwestphal

The GeoKnow Handbooktechreport

Authors: Jens Lehmann, Spiros Athanasiou, Andreas Both, Lorenz Buehmann, Alejandra Garcia-Rojas, Giorgos Giannopoulos, Daniel Hladky, Konrad Hoeffner, Jon Jay Le Grange, Axel-Cyrille Ngonga Ngomo, Rene Pietzsch, Robert Isele, Mohamed Ahmed Sherif, Claus Stadler, Matthias Wauer, Patrick Westphal

Published in:

Publication date: 2015

Tags: 2015MOLEbuehmanndicegeoknowgroup_akswhoeffnerlehmannngongasherifsimbawestphal

OKBQA Framework for collaboration on developing natural language question answering systemsarticle

Authors: Jin-Dong Kim, Christina Unger, Axel-Cyrille Ngonga Ngomo, André Freitas, Young-gyun Hahm, Jiseong Kim, Sangha Nam, Gyu-Hyun Choi, Jeong-uk Kim, Ricardo Usbeck, others

Published in:

Publication date: 2017

Tags: agdistisdieselgroup_akswhawkngongaqamelsimbausbeck

OKBQA: an Open Collaboration Framework for Development of Natural Language Question-Answering over Knowledge Basesinproceedings

Authors: Jin-Dong Kim, Christina Unger, Axel-Cyrille Ngonga Ngomo, André Freitas, YoungGyun Hahm, Jiseong Kim, Gyu-Hyun Choi, Jeonguk Kim, Ricardo Usbeck, Myoung-Gu Kang, Key-Sun Choi

Published in: Proceedings of the ISWC 2017 Posters & Demonstrations and Industry Tracks co-located with 16th International Semantic Web Conference (ISWC 2017), Vienna, Austria, October 23rd - to - 25th, 2017.

Publication date: 2017

Tags: agdistisdieselgroup_akswhawkngongaqamelsimbausbeck

SAFE: Policy Aware SPARQL Query Federation Over RDF Data Cubesinproceedings

Authors: Yasar Khan, Muhammad Saleem, Aftab Iqbal, Muntazir Mehdi, Aidan Hogan, Panagiotis Hasapis, Axel-Cyrille Ngonga Ngomo, Stefan Decker, Ratnesh Sahay

Published in: Semantic Web Applications and Tools for Life Sciences(SWAT4LS)

Publication date: 2014

Tags: group_akswngongaquetsalsaleemsimba

RADON results for OAEI 2017inproceedings

Authors: Mohamed Ahmed Sherif andAxel-Cyrille Ngonga Ngomo Kevin Dreßler

Published in: Proceedings of Ontology Matching Workshop 2017

Publication date: 2017

Tags: 2017dicedieselgeisergroup_akswhobbitkevinledslimeslinkinglodngongaradonsagesakesherifsimbaslipo

GenomeSnip: Fragmenting the Genomic Wheel to augment discovery in cancer researchinproceedings

Authors: Maulik R Kamdar, Aftab Iqbal, Muhammad Saleem, Helena F Deus, Stefan Decker

Published in: Conference on Semantics in Healthcare and Life Sciences (CSHALS) 2014

Publication date: 2014

Tags: group_akswsaleemsimbatcga

Eaglet -- a Named Entity Recognition and Entity Linking Gold Standard Checking Toolinproceedings

Authors: Kunal Jha, Michael Röder, Axel-Cyrille Ngonga Ngomo

Published in: The Semantic Web. Latest Advances and New Domains: 14th International Conference, ESWC 2017, Proceedings

Publication date: 2017

Tags: group_akswkunaljhangongaprojecthobbitroedersimba

All That Glitters is not Gold -- Rule-Based Curation of Reference Datasets for Named Entity Recognition and Entity Linkinginproceedings

Authors: Kunal Jha, Michael Röder, Axel-Cyrille Ngonga Ngomo

Published in: The Semantic Web. Latest Advances and New Domains: 14th International Conference, ESWC 2017, Proceedings

Publication date: 2017

Tags: group_akswkunaljhangongaprojecthobbitroedersimba

An Incomplete and Simplifying Introduction to Linked Dataincollection

Authors: Anja Jentzsch, Ricardo Usbeck, Denny Vrandecic

Published in: Perspectives on Ontology Learning

Publication date: 2014

Tags: 2014MOLEgroup_akswlehmannmolesimbausbeck

Applying ontology design patterns to the implementation of relations in GENIAinproceedings

Authors: Robert Hoehndorf, Axel-Cyrille Ngonga Ngomo, Sampo Pyysalo, Tomoko Ohta, Anika Oellrich, Dietrich Rebholz-Schuhmann

Published in: Proceedings of the fourth International Symposium for Semantic Mining in Biomedicine

Publication date: 2010

Tags: SIMBAgroup_akswngonga

Specifying relations between genes and gene products in GENIAarticle

Authors: Robert Hoehndorf, Axel-Cyrille Ngonga Ngomo, Sampo Pyysalo, Tomoko Ohta, Anika Oellrich, Dietrich Rebholz-Schuhmann

Published in: Journal of Biomedical Semantics

Publication date: 2011

Tags: SIMBAevent_eckmgroup_akswngonga

The application of an ontology design pattern for functional abnormalities to phenotype ontologies and the extraction of an ontology of anatomical functionsinproceedings

Authors: Robert Hoehndorf, Axel-Cyrille Ngonga Ngomo, Janet Kelso

Published in: Proceedings of the third International Symposium on Languages in Bio-Medicine

Publication date: 2009

Tags: SIMBAgroup_akswngonga

Applying the functional abnormality ontology pattern to anatomical functionsarticle

Authors: Robert Hoehndorf, Axel-Cyrille Ngonga Ngomo, Janet Kelso

Published in: Journal of Biomedical Semantics

Publication date: 2010

Tags: SIMBAgroup_akswngonga

Developing Consistent and Modular Software Models with Ontologiesinproceedings

Authors: Robert Hoehndorf, Axel-Cyrille Ngonga Ngomo, Heinrich Herre

Published in: Proceedings of the 8th International Conference on Software Methodologies, Tools, and Techniques

Publication date: 2009

Tags: SIMBAgroup_akswngonga

From Terms to Categories: Testing the Significance of Co-occurrences between Ontological Categoriesinproceedings

Authors: Robert Hoehndorf, Axel-Cyrille Ngonga Ngomo, Michael Dannemann, Janet Kelso

Published in: Proceedings of the Third International Symposium on Semantic Mining in Biomedicine

Publication date: 2008

Tags: SIMBAgroup_akswngonga

Statistical tests for associations between two directed acyclic graphsarticle

Authors: Robert Hoehndorf, Axel-Cyrille Ngonga Ngomo, Michael Dannemann, Janet Kelso

Published in: PLOS One

Publication date: 2010

Tags: SIMBAgroup_akswngonga

Towards Ontological Interpretations for Improved Text Mininginproceedings

Authors: Robert Hoehndorf, Axel-Cyrille Ngonga Ngomo, Michael Dannemann

Published in: Proceedings of the Third International Symposium on Semantic Mining in Biomedicine

Publication date: 2008

Tags: SIMBAgroup_akswngonga

Parallelizing LIMES for Large-Scale Link Discoveryinproceedings

Authors: Stanley Hillner, Axel-Cyrille Ngonga Ngomo

Published in: I'Semantics

Publication date: 2011

Tags: SIMBAgroup_akswlimesngongascms

The TIGER Corpus Navigatorinproceedings

Authors: Sebastian Hellmann, Jörg Unbehauen, Christian Chiarcos, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of the Ninth International Workshop on Treebanks and Linguistic Theories (TLT9)

Publication date: 2010

Tags: 2010MOLEchiarcosdllearnerevent_TLTgroup_akswhellmannkiltngongasimbaunbehauen

ACRyLIQ: Leveraging DBpedia for Adaptive Crowdsourcing in Linked Data Quality Assessmentinproceedings

Authors: Umair Ul Hassan, Edward Curry, Amrapali Zaveri, Edgard Marx, Jens Lehmann

Published in: 20th International Conference on Knowledge Engineering and Knowledge Management (EKAW), November 19-23, 2016, Bologna, Italy

Publication date: 2016

Tags: MOLEgroup_akswlehmannmarxmolesimbazaveri

Using Caching for Local Link Discovery on Large Data Setsincollection

Authors: Mofeed M. Hassan, René Speck, Axel-Cyrille Ngonga Ngomo

Published in: Engineering the Web in the Big Data Era

Publication date: 2015

Tags: 2015SIMBAgeoknowhassanngongaspeck

Extending LargeRDFBench for Multi-Source Data at Scale for SPARQL Endpoint Federationinproceedings

Authors: Ali Hasnainb, Muhammad Saleem, Axel-Cyrille Ngonga Ngomo, Dietrich Rebholz-Schuhmann

Published in: ISWC Satellite, SSWS

Publication date: 2018

Tags: dieselerdoganethemfeasiblegroup_akswlsqngongaprojecthobbitquetsalsakesaleemsimba

Federated Query Formulation and Processing through BioFedinproceedings

Authors: Ali Hasnain, Syeda Sana e Zainab, Dure Zehra, Qaiser Mehmood, Muhammad Saleem, Dietrich Rebholz-Schuhmann

Published in: SeWebMDA workshop at ESWC

Publication date: 2017

Tags: group_akswhasnainsaleemsanasimba

Survey on Challenges of Question Answering in the Semantic Webarticle

Authors: Konrad Höffner, Sebastian Walter, Edgard Marx, Ricardo Usbeck, Jens Lehmann, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Journal

Publication date: 2017

Tags: dieselgroup_akswhawkhoeffnerlehmannmarxmolengongaopenqaprojecthobbitqamelsimbasinatbslusbeck

User Interface for a Template Based Question Answering Systeminproceedings

Authors: Konrad Höffner, Christina Unger, Lorenz Bühmann, Jens Lehmann, Axel-Cyrille Ngonga Ngomo, Daniel Gerber, Phillip Cimiano

Published in: Proceedings of the 4th Conference on Knowledge Engineering and Semantic Web

Publication date: 2013

Tags: 2013MOLESIMBAautosparqlbuehmanngroup_akswhoeffnerlehmannngongatbsltopic_Queryingtopic_Search

LinkedSpending: OpenSpending becomes Linked Open Dataarticle

Authors: Konrad Höffner, Michael Martin, Jens Lehmann

Published in: Semantic Web Journal

Publication date: 2015

Tags: DataMOLEOpenOpenSpendingRDFSIMBAbudgetexpenditurefinancegroup_akswhoeffnerlehmannlinkedspendingmartinpublicsemantictransparencyweb

CubeQA---Question Answering on RDF Data Cubesinproceedings

Authors: Konrad Höffner, Jens Lehmann, Ricardo Usbeck

Published in: Proceedings of the 15th International Semantic Web Conference (ISWC2016)

Publication date: 2016

Tags: group_akswhoeffnerlehmannsimbausbeck

The GeoKnow Generator: Managing Geospatial Data in the Linked Data Webinproceedings

Authors: Jon Jay Le Grange, Jens Lehmann, Spiros Athanasiou, Alejandra Garcia Rojas, Giorgos Giannopoulos, Daniel Hladky, Robert Isele, Axel-Cyrille Ngonga Ngomo, Mohamed Ahmed Sherif, Claus Stadler, Matthias Wauer

Published in: Proceedings of the Linking Geospatial Data Workshop

Publication date: 2014

Tags: 2014MOLEdicegeoknowgroup_akswgroup_molelehmannlodlod2pagemolengongapeer-reviewedsherifsimbastadlertopic_Lifecyclewauer

Real-time RDF extraction from unstructured data streamsinproceedings

Authors: Daniel Gerber, Axel-Cyrille Ngonga Ngomo, Sebastian Hellmann, Tommaso Soru, Lorenz Bühmann, Ricardo Usbeck

Published in: Proceedings of ISWC

Publication date: 2013

Tags: buehmanngerbergroup_akswhellmannkiltngongasimbasoruusbeck

Bootstrapping the Linked Data Webinproceedings

Authors: Daniel Gerber, Axel-Cyrille Ngonga Ngomo

Published in: 1st Workshop on Web Scale Knowledge Extraction @ ISWC 2011

Publication date: 2011

Tags: 2011SIMBAboaevent_iswcevent_wekexgerbergroup_akswngonga

From RDF to Natural Language and Backincollection

Authors: Daniel Gerber, Axel-Cyrille Ngonga Ngomo

Published in: Towards the Multilingual Semantic Web

Publication date: 2014

Tags: SIMBAboafoxgerbergroup_akswngonga

DeFacto - Temporal and Multilingual Deep Fact Validationarticle

Authors: Daniel Gerber, Diego Esteves, Jens Lehmann, Lorenz Bühmann, Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo, René Speck

Published in: Web Semantics: Science, Services and Agents on the World Wide Web

Publication date: 2015

Tags: 2015MOLEbuehmanndefactodieselestevesgeoknowgerbergroup_akswlehmannngongasimbaspeckusbeck

MOCHA2018: The Mighty Storage Challenge at ESWC 2018inproceedings

Authors: Kleanthi Georgala, Mirko Spasić, Milos Jovanovik, Vassilis Papakonstantinou, Claus Stadler, Michael Röder, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Evaluation Challenges

Publication date: 2018

Tags: dicegeorgalagroup_akswngongaprojecthobbitroedersimba

MOCHA2017: The Mighty Storage Challenge at ESWC 2017inproceedings

Authors: Kleanthi Georgala, Mirko Spasić, Milos Jovanovik, Henning Petzka, Michael Röder, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Evaluation Challenge

Publication date: 2017

Tags: dicegeorgalagroup_akswngongaprojecthobbitroedersimba

An Efficient Approach for the Generation of Allen Relationsinproceedings

Authors: Kleanthi Georgala, Mohamed Ahmed Sherif, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of the 22nd European Conference on Artificial Intelligence (ECAI) 2016, The Hague, 29. August - 02. September 2016

Publication date: 2016

Tags: dicegeorgalagroup_akswlimesngongaprojecthobbitsakesherifsimba

Dynamic Planning for Link Discoveryinproceedings

Authors: Kleanthi Georgala, Daniel Obraczka, Axel-Cyrille Ngonga Ngomo

Published in: The Semantic Web, ESWC 2018, Lecture Notes in Computer Science

Publication date: 2018

Tags: LinkingLODdicegeisergeorgalagroup_akswlimesngongaobraczkaprojecthobbitsakesimbaslipo

An Evaluation of Models for Runtime Approximation in Link Discoveryinproceedings

Authors: Kleanthi Georgala, Michael Hoffmann, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of the International Conference on Web Intelligence

Publication date: 2017

Tags: approximationdicediscovery,georgalagroup_akswlimeslinkngongaprojecthobbitruntimesakeseriessimbaspecificationstaylor

Scalable Link Discovery for Modern Data-Driven Applicationsinproceedings

Authors: Kleanthi Georgala

Published in: Proceedings of the The 15th International Semantic Web Conference (ISWC2016) 2016, Doctoral Consortium Track, Kobe, Japan, 17. October - 21. October 2016

Publication date: 2016

Tags: dicegeorgalagroup_akswlimesprojecthobbitsakesimba

SMORE---A Semantic Model Repositoryinproceedings

Authors: Martin Gebauer, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of the 1st Workshop of Knowledge Reuse at the International Conference on Software Reuse (ICSR)

Publication date: 2008

Tags: SIMBAgroup_akswngonga

Question Answering Mediated by Visual Clues and Knowledge Graphsinproceedings

Authors: Fabr\'ıcio F. de Faria, Ricardo Usbeck, Alessio Sarullo, Tingting Mu, André Freitas

Published in: Companion of the The Web Conference 2018 on The Web Conference 2018, WWW 2018, Lyon , France, April 23-27, 2018

Publication date: 2018

Tags: 2018group_akswsimbausbeck

LOG4MEX: A Library to Export Machine Learning Experimentsinproceedings

Authors: Diego Esteves, Diego Moussallem, Tommaso Soru, Ciro Baron Neto, Jens Lehmann, Axel-Cyrille Ngonga Ngomo, Julio Cesar Duarte

Published in: WI '17 - IEEE/WIC/ACM International Conference on Web Intelligence

Publication date: 2017

Tags: diceestevesgroup_akswlehmannmoussallemngongaproject-hobbitprojecthobbitsdasimba

MEX Vocabulary: A Lightweight Interchange Format for Machine Learning Experimentsinproceedings

Authors: Diego Esteves, Diego Moussallem, Ciro Baron Neto, Tommaso Soru, Ricardo Usbeck, Markus Ackermann, Jens Lehmann

Published in: 11th International Conference on Semantic Systems (SEMANTiCS 2015), 15-17 September 2015, Vienna, Austria

Publication date: 2015

Tags: 2015MOLEackermannalignedaligned-projectbaronestevesgroup_akswlehmannmackmexmolemoussallemnetosimbasoruusbeck

GENESIS -- A Generic RDF Data Access Interfaceinproceedings

Authors: Timofey Ermilov, Diego Moussallem, Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo

Published in: WI '17 - IEEE/WIC/ACM International Conference on Web Intelligence

Publication date: 2017

Tags: dicedieselermilovgroup_akswmoussallemngongaproject-hobbitprojecthobbitqamelsimbausbeck

Data Licensing on the Cloud - Empirical Insights and Implications for Linked Datainproceedings

Authors: Ivan Ermilov, Tassilo Pellegrini

Published in: SEMANTiCS 2015

Publication date: 2015

Tags: 2015geoknowgroup_akswiermilovsakesimba

TAIPAN: Automatic Property Mapping for Tabular Datainproceedings

Authors: Ivan Ermilov, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of 20th International Conference on Knowledge Engineering and Knowledge Management (EKAW'2016)

Publication date: 2016

Tags: 2016dieselgeisergroup_akswiermilovngongaprojecthobbitsimba

Managing Lifecycle of Big Data Applicationsinproceedings

Authors: Ivan Ermilov, Axel-Cyrille Ngonga Ngomo, Aad Versteden, Hajira Jabeen, Gezim Sejdiu, Giorgos Argyriou, Luigi Selmi, Jürgen Jakobitsch, Jens Lehmann

Published in: Knowledge Engineering and Semantic Web

Publication date: 2017

Tags: 2017bdedicegroup_akswiermilovjabeenlehmannngongasejdiusimba

Simplifying the Deployment of Big Data Solutionsinproceedings

Authors: Ivan Ermilov, Axel-Cyrille Ngonga Ngomo

Published in: KESW Demo/Poster Track

Publication date: 2017

Tags: bdegroup_akswiermilovngongasimba

LODStats: The Data Web Census Datasetinproceedings

Authors: Ivan Ermilov, Jens Lehmann, Michael Martin, Sören Auer

Published in: Proceedings of 15th International Semantic Web Conference - Resources Track (ISWC'2016)

Publication date: 2016

Tags: 2016auerbdegroup_akswiermilovledslehmannlodstatsmartinsimba

kOre: Using Linked Data for OpenScience Information Integrationinproceedings

Authors: Ivan Ermilov, Konrad Höffner, Jens Lehmann, Dmitry Mouromtsev

Published in: SEMANTiCS 2015

Publication date: 2015

Tags: 2015geoknowgroup_akswhoeffneriermilovlehmannsakesimba

On the Efficient Execution of Bounded Jaro-Winkler Distancesinproceedings

Authors: Kevin Dreßler, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Journal

Publication date: 2016

Tags: SIMBAdieselgeoknowgroup_akswkevinledslimeslinkinglodngongasake

Time-Efficient Execution of Bounded Jaro-Winkler Distancesinproceedings

Authors: Kevin Dreßler, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of Ontology Matching Workshop

Publication date: 2014

Tags: SIMBAdieselgeoknowgroup_akswkevinlimeslinkinglodngongasake

Scalable Approach for Computing Semantic Relatedness using Semantic Web Datainproceedings

Authors: Dennis Diefenbach, Ricardo Usbeck, Kamal Deep Singh, Pierre Maret

Published in: Proceedings of the International Conference on Web Intelligence, Mining and Semantics

Publication date: 2016

Tags: agdistisdieselgroup_akswqamelsimbausbeck

SESSA - Keyword-Based Entity Search through Coloured Spreading Activationarticle

Authors: Denis Lukovnikov, Axel-Cyrille Ngonga Ngomo

Published in: NLIWOD workshop at ISWC

Publication date: 2014

Tags: dicegroup_akswngongasimba

IGUANA: A Generic Framework for Benchmarking the Read-Write Performance of Triple Storesinproceedings

Authors: Felix Conrads, Jens Lehmann, Muhammad Saleem, Mohamed Morsey, and Axel-Cyrille Ngonga Ngomo

Published in: International Semantic Web Conference (ISWC)

Publication date: 2017

Tags: group_akswjens-lehmannlehmannmolengongasaleemsimba

CROCUS: Cluster-based ontology data cleansinginproceedings

Authors: Didier Cherix, Ricardo Usbeck, Andreas Both, Jens Lehmann

Published in: Proceedings of the 2nd International Workshop on Semantic Web Enterprise Adoption and Best Practice

Publication date: 2014

Tags: 2014MOLEdllearnergroup_akswlehmannontologysimbatopic_EvolutionRepairusbeck

Lessons Learned---the Case of CROCUS: Cluster-based ontology data cleansinginproceedings

Authors: Didier Cherix, Ricardo Usbeck, Andreas Both, Jens Lehmann

Published in: ESWC Best of Workshops

Publication date: 2014

Tags: MOLEgroup_akswlehmannsimbausbeck

UPSP: Unique Predicate-based Source Selection for SPARQL Endpoint Federationinproceedings

Authors: Ethem Cem Ozkan, Muhammad Saleem, Erdogan Dogdu, Axel-Cyrille Ngonga Ngomo

Published in: PROFILES at Extended Semantic Web Conference (ESWC)

Publication date: 2016

Tags: dieselerdoganethemfeasiblegroup_akswlsqngongaprojecthobbitquetsalsakesaleemsimba

Linked SDMX Dataarticle

Authors: Sarven Capadisli, Sören Auer, Axel-Cyrille Ngonga Ngomo

Published in: Semantic Web Journal

Publication date: 2013

Tags: 2013SIMBAauerbioasqcapadisligroup_akswlimesngongapeer-reviewedsdmx

Joint proceedings of the second RDF stream processing and the querying the web of data workshopsproceedings

Authors: JP Calbimonte, MD Tran, D Dell'Aglio, D Le Phuoc, Muhammad Saleem, Ricardo Usbeck, Ruben Verborgh, Axel Ngonga

Published in: Second RDF Stream Processing and the Querying the Web of Data Workshops

Publication date: 2017

Tags: dicedieselgroup_akswngongasaleemsimbausbeck

A Service-oriented Search Framework for Full Text, Geospatial and Semantic Searchinproceedings

Authors: Andreas Both, Axel-Cyrille Ngomo Ngonga, Ricardo Usbeck, Denis Lukovnikov, Christiane Lemke, Maximilian Speicher

Published in: SEMANTiCS 2014

Publication date: 2014

Tags: 2014group_akswlukovnikovngongasimbatopic_Searchtopic_geospatial,usbeck

Results of the BioASQ Track of the Question Answering Lab at CLEF 2014inproceedings

Authors: George Balikas, Ioannis Partalas, Axel-Cyrille Ngonga Ngomo, Anastasia Krithara, Eric Gaussier, George Paliouras

Published in: Proceedings of CLEF

Publication date: 2014

Tags: 2014SIMBAbioasqgroup_akswngongapeer-reviewed

Web-Scale Extension of RDF Knowledge Bases from Templated Websitesinproceedings

Authors: Lorenz Bühmann, Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo, Muhammad Saleem, Andreas Both, Valter Crescenzi, Paolo Merialdo, Disheng Qiu

Published in: International Semantic Web Conference (ISWC)

Publication date: 2014

Tags: buehmannextractiongroup_akswngongardfrexsaleemsimbausbeck

ASSESS --- Automatic Self-Assessment Using Linked Datainproceedings

Authors: Lorenz Bühmann, Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo

Published in: International Semantic Web Conference (ISWC)

Publication date: 2015

Tags: assessbuehmanngroup_akswmolengongasimbausbeck

Introduction to Linked Data and Its Lifecycle on the Webincollection

Authors: Sören Auer, Jens Lehmann, Axel-Cyrille Ngonga Ngomo

Published in: Reasoning Web. Semantic Technologies for the Web of Data

Publication date: 2011

Tags: 2011MOLESIMBAauergroup_akswlehmannngonga

Introduction to Linked Data and Its Lifecycle on the Webinproceedings

Authors: Sören Auer, Jens Lehmann, Axel-Cyrille Ngonga Ngomo, Amrapali Zaveri

Published in: Reasoning Web

Publication date: 2013

Tags: 2013MOLESIMBAauergroup_akswlehmannngongasimbatopic_GeoSemWebzaveri

Extraktion, Mapping und Verlinkung von Daten im Webarticle

Authors: Sören Auer, Jens Lehmann, Axel-Cyrille Ngonga Ngomo, Claus Stadler, Jörg Unbehauen

Published in: Datenbank Spektrum

Publication date: 2013

Tags: 2013MOLEauergroup_akswlehmannlinkinglodmolengongasimbastadlertopic_Extraction,topic_Interlinking,topic_Mapunbehauen

Joint proceedings of the 4th Workshop on Semantic Deep Learning (SemDeep-4) and NLIWoD4: Natural Language Interfaces for the Web of Data (NLIWOD-4) and 9th Question Answering over Linked Data challenge (QALD-9) co-located with 17th International Semantic Web Conference (ISWC 2018), Monterey, California, United States of America, October 8th - 9th, 2018proceedings

Authors: Key-Sun Choi, Luis Espinosa Anke, Thierry Declerck, Dagmar Gromann, Jin-Dong Kim, Axel-Cyrille Ngonga Ngomo, Muhammad Saleem, Ricardo Usbeck

Published in:

Publication date: 2018

Tags: 2018dicegroup_akswlimbolimboprojectngongaqamelsaleemsimbasolideusbeck

Enhancing Community Interactions with Data-Driven Chatbots-The DBpedia Chatbotinproceedings

Authors: Ram G. Athreya, Axel-Cyrille Ngonga Ngomo, Ricardo Usbeck

Published in: Companion of the The Web Conference 2018 on The Web Conference 2018, WWW 2018, Lyon , France, April 23-27, 2018

Publication date: 2018

Tags: 2018group_akswlimbolimboprojectngongaopalsimbasolideusbeck

QFed: Query Set For Federated SPARQL Query Benchmarkinproceedings

Authors: Nur Aini Rakhmawati, Muhammad Saleem, Sarasi Lalithsena, Stefan Decker

Published in: The 16th International Conference on Information Integration and Web-based Applications & Services (iiWAS2014)

Publication date: 2014

Tags: group_akswquetsalsaleemsimba

On the Effect of Geometries Simplification on Geo-spatial Link Discoveryinproceedings

Authors: Abdullah Fathi Ahmed, Mohamed Ahmed Sherif, Axel-Cyrille Ngonga Ngomo

Published in: SEMANTiCS 2018 - Research Track

Publication date: 2018

Tags: 2018abdullahdicegroup_akswlimesngongaprojecthobbitsagesherifsimbaslipo

DICE @ TREC-IS 2018: Combining Knowledge Graphs and Deep Learning to Identify Crisis-Relevant Tweetsinproceedings

Authors: Hamada M. Zahera, Rricha Jalota, Ricardo Usbeck

Published in: Proceedings of the Twenty-Seventh Text REtrieval Conference, TREC 2018, Gaithersburg, Maryland, USA, November 14-16, 2018

Publication date: 2018

Tags: 2018group_akswlimbolimboprojectsimbasolideusbeck

Introducing the HOBBIT platform into the Ontology Alignment Evaluation Campaigninproceedings

Authors: Ernesto Jiménez-Ruiz, Tzanina Saveta, Ondrej Zamazal, Sven Hertling, Michael Röder, Irini Fundulaki, Axel-Cyrille Ngonga Ngomo, Mohamed Ahmed Sherif, Amina Annane, Zohra Bellahsene, Sadok Ben Yahia, Gayo Diallo, Daniel Faria, Marouen Kachroudi, Abderrahmane Khiat, Patrick Lambrix, Huanyu Li, Maximilian Mackeprang, Majid Mohammadi, Maciej Rybinski, Booma Sowkarthiga Balasubramani, Cassia Trojahn

Published in: Proceedings of the Ontology Matching Workshop 2018

Publication date: 2018

Tags: 2018DICESIMBAgroup_akswngongaprojecthobbitroedersherif

9th Challenge on Question Answering over Linked Data (QALD-9) (invited paper)inproceedings

Authors: Ricardo Usbeck, Ria Hari Gusmita, Axel-Cyrille Ngonga Ngomo, Muhammad Saleem

Published in: Joint proceedings of the 4th Workshop on Semantic Deep Learning (SemDeep-4) and NLIWoD4: Natural Language Interfaces for the Web of Data (NLIWOD-4) and 9th Question Answering over Linked Data challenge (QALD-9) co-located with 17th International Semantic Web Conference (ISWC 2018), Monterey, California, United States of America, October 8th - 9th, 2018.

Publication date: 2018

Tags: 2018dieselgroup_akswlimbolimboprojectngongaqamelsimbasolideusbeck

8th Challenge on Question Answering over Linked Data (QALD-8)inproceedings

Authors: Ricardo Usbeck, Axel-Cyrille Ngonga Ngomo, Felix Conrads, Michael Röder, Giulio Napolitano

Published in: Joint proceedings of the 4th Workshop on Semantic Deep Learning (SemDeep-4) and NLIWoD4: Natural Language Interfaces for the Web of Data (NLIWOD-4) and 9th Question Answering over Linked Data challenge (QALD-9) co-located with 17th International Semantic Web Conference (ISWC 2018), Monterey, California, United States of America, October 8th - 9th, 2018.

Publication date: 2018

Tags: 2018conradsdieselgroup_akswlimbolimboprojectngongaqamelroedersimbasolideusbeck

Big POI data integration with Linked Data technologiesinproceedings

Authors: Spiros Athanasiou, Giannopoulos Giorgos, Graux Damien, Karagiannakis Nikos, Lehmann Jens, Axel-Cyrille Ngonga Ngomo, Patroumpas Kostas, Mohamed Ahmed Sherif, Dimitrios Skoutas

Published in: International Conference on Extending Database Technology 2019, EDBT19

Publication date: 2019

Tags: 2019deerdicegroup_akswlehmannlimesngongasherifsimbaslipo

LSVS: Link Specification Verbalization and Summarizationinproceedings

Authors: Abdullah Fathi Ahmed, Mohamed Ahmed Sherif, Axel-Cyrille Ngonga Ngomo

Published in: 24th International Conference on Applications of Natural Language to Information Systems (NLDB 2019)

Publication date: 2019

Tags: 2019ahmeddicegroup_akswlimbolimesngongaopalsagesherifsimbaslipo

Towards a Semantic Message-driven Microservice Platform for Geospatial and Sensor Datainproceedings

Authors: Matthias Wauer, Axel-Cyrille Ngonga Ngomo

Published in:

Publication date: 2018

Tags: 2018dicegeisergroup-akswngongasimbawauer

BENGAL: An Automatic Benchmark Generator for Entity Recognition and Linkinginproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Michael Röder, Diego Moussallem, Ricardo Usbeck, René Speck

Published in: Proceedings of the 11th International Conference on Natural Language Generation, Tilburg University, The Netherlands, November 5-8, 2018

Publication date: 2018

Tags: dicegroup_akswmoussallemngongaprojecthobbitroedersimbaspeckusbeck

Question Answering on interlinked datainproceedings

Authors: Saeedeh Shekarpour, Axel-Cyrille Ngonga Ngomo, Sören Auer

Published in: WWW

Publication date: 2013

Tags: SIMBAauergroup_akswngongashekarpoursimsina

The Lazy Traveling Salesman - Memory Management for Large-Scale Link Discovery.inproceedings

Authors: Axel-Cyrille Ngonga Ngomo, Mofeed M. Hassan

Published in: ESWC

Publication date: 2016

Tags: 2016SIMBAdblphassanngonga

LimesWebUI – Link Discovery Made Simpleinproceedings

Authors: Mohamed Ahmed Sherif, Svetlana Pestryakova, Kevin Dreßler, Axel-Cyrille Ngonga Ngomo

Published in: 18th International Semantic Web Conference (ISWC 2019)

Publication date: 2019

Tags: 2019Svetlanadicegroup_akswkevinlimbolimesngongaopalsagesherifsimbaslipo

Enriching the WebNLG corpusinproceedings

Authors: Thiago Castro Ferreira, Diego Moussallem, Emiel Krahmer, Sander Wubben

Published in: Proceedings of the 11th International Conference on Natural Language Generation

Publication date: 2018

Tags: dicegroup_akswmoussallemngonga

A High-Performance Approach to String Similarity using Most Frequent K Charactersinproceedings

Authors: Andre Valdestilhas, Tommaso Soru, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of the Ontology Matching Workshop (co-located with ISWC 2017)

Publication date: 2017

Tags: 2017DICEgeisergroup_akswngongaprojecthobbittsoruvaldestilhas

CEDAL: Time-efficient Detection of Erroneous Links in Large-scale Link Repositoriesinproceedings

Authors: Andre Valdestilhas, Tommaso Soru, Axel-Cyrille Ngonga Ngomo

Published in: Proceedings of the International Conference on Web Intelligence

Publication date: 2017

Tags: 2017DICEgeisergroup_akswngongatsoruvaldestilhas

Dragon: Decision Tree Learning for Link Discovery.inproceedings

Authors: Daniel Obraczka, Axel-Cyrille Ngonga Ngomo

Published in: ICWE

Publication date: 2019

Tags: dicegroup_akswlimboprojectlimesngongaobraczkaopal